SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714008|ref|YP_206783.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714008|ref|YP_206783.1|
Domain Number 1 Region: 7-312
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 2.75e-59
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59714008|ref|YP_206783.1|
Sequence length 316
Comment ferric anguibactin transport system permease protein FatC [Vibrio fischeri ES114]
Sequence
MSDSIKLTALAFITVLFTFLFIGIGLDASNYEYFLSRRVPKVLAMILASIAIAQSSLVFQ
TITHNRILTPSIMGFDALYLLTQVLVVVIFGSFSVFILNPFLNFAMSVVIMVGFSLLLFG
FYFKKNNSNVITLLLLGVIFGQLFSNISSFFTMLVDPNDFASIQSSMFASFNNINKDLVY
FCVIPLLLISAVLFRMSNILDVFWLDNDNATSLGVDVGKVTKQVLILVAILISVSTALVG
PVMFFGLLVANLAKEFFHTYRHRTLLLGSSLMAMSMLLSGQWVIENIFKFETTLSVVINF
IGGLYFLSLLVRQKIQ
Download sequence
Identical sequences B5EUY2 Q5DZA1
WP_011263644.1.21775 WP_011263644.1.21836 WP_011263644.1.23113 WP_011263644.1.44395 WP_011263644.1.76652 WP_011263644.1.81434 YP_206783.1.56684 gi|197337763|ref|YP_002158500.1| 312309.VF_A0825 388396.VFMJ11_A0952 gi|59714008|ref|YP_206783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]