SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714021|ref|YP_206796.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714021|ref|YP_206796.1|
Domain Number 1 Region: 52-214
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.7e-28
Family VanY-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59714021|ref|YP_206796.1|
Sequence length 301
Comment hypothetical protein VF_A0838 [Vibrio fischeri ES114]
Sequence
MKKNRLLTALALFFCSAPSFANISNLTAGQCQAMIGKGVMSTKAPVQCDRLRNVTFKHYT
FNGKTATGKLVVLDAVASHVERIFDELYQQGFPIALAKPIEYYAGNDNKSMDANNTSAFN
YRPIVGKSSLSLHAYGAAIDINPLQNPFVEFTSWGTATFKPLKGHEYSNRMLQRLGKEDR
KGFAEEVINIFAQNGFIYWGGYWDTPIDFQHFQTSRDMAYLMTAMPTKEASLFFNHYVDW
VQSCQQNYGSKQMNKFKDYTSYLQTELKTTTSLNRLYKANPNAVMQAINKKAHVSQSRCF
K
Download sequence
Identical sequences Q5DZ88
gi|59714021|ref|YP_206796.1| 312309.VF_A0838 WP_011263657.1.76652 YP_206796.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]