SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714024|ref|YP_206799.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714024|ref|YP_206799.1|
Domain Number 1 Region: 25-143,259-409
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.62e-79
Family Substrate-binding domain of HMG-CoA reductase 0.0000185
Further Details:      
 
Domain Number 2 Region: 146-261
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 2.75e-35
Family NAD-binding domain of HMG-CoA reductase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59714024|ref|YP_206799.1|
Sequence length 419
Comment 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vibrio fischeri ES114]
Sequence
MPKLNLHRRDYVSILGGDISADKLEQSLNPHFEKPLNKITPSPYLTEKNLTRRWDKLAKP
ELQSELLDPHTQNQMHVYEKNIEHFIGTVKLPVGLAGPLRVNGLFANDDYLVPLATTEAA
LVASYNRGAQLLTASGGASAMLLNEGVTRTPAFAFFGLAEAGQFVAWAVTQYDTFKQLAE
STTSHGKLSDINISIEGNHVYLVFEFLTGDASGQNMVTIATNAVFSYIMENSPITPENAY
LDGNLSGDKKASSQTLRSVRGKKVTAEAHIPAKLVKKYLHTTPEKMMQFTQMSTVGATLS
GTIGINAHYANALAALYIACGQDAACVAESAIGMTRIEVDRNGDLYASVTLPNLMLGTVG
GGTGLPSQKACLELMGLHGAGKSQALAEVCAALCLAGELSIVGAFCAGHFSRAHHKLAR
Download sequence
Identical sequences Q5DZ85
gi|59714024|ref|YP_206799.1| NYSGRC-FDAO-AAW87911 WP_011263659.1.34959 WP_011263659.1.76652 YP_206799.1.56684 312309.VF_A0841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]