SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714108|ref|YP_206883.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714108|ref|YP_206883.1|
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily Pheromone-binding domain of LuxR-like quorum-sensing transcription factors 7.32e-36
Family Pheromone-binding domain of LuxR-like quorum-sensing transcription factors 0.0018
Further Details:      
 
Domain Number 2 Region: 174-243
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000000299
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59714108|ref|YP_206883.1|
Sequence length 250
Comment autoinducer-binding transcriptional activator protein LuxR [Vibrio fischeri ES114]
Sequence
MNIKNINANEKIIDKIKTCNNNKDINQCLSEIAKIIHCEYYLFAIIYPHSIIKPDVSIID
NYPEKWRKYYDDAGLLEYDPVVDYSKSHHSPINWNVFEKKTIKKESPNVIKEAQESGLIT
GFSFPIHTASNGFGMLSFAHSDKDIYTDSLFLHASTNVPLMLPSLVDNYQKINTTRKKSD
SILTKREKECLAWASEGKSTWDISKILGCSERTVTFHLTNTQMKLNTTNRCQSISKAILT
GAINCPYLKN
Download sequence
Identical sequences P35327
WP_011263745.1.100783 WP_011263745.1.102040 WP_011263745.1.11820 WP_011263745.1.21836 WP_011263745.1.66091 WP_011263745.1.76652 WP_011263745.1.77059 WP_011263745.1.80135 WP_011263745.1.82276 WP_011263745.1.94618 YP_206883.1.56684 312309.VF_A0925 gi|59714108|ref|YP_206883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]