SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714303|ref|YP_207078.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714303|ref|YP_207078.1|
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.62e-36
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59714303|ref|YP_207078.1|
Sequence length 212
Comment hydrogenase cytochrome B-type subunit [Vibrio fischeri ES114]
Sequence
MKIWDLPTRIYHWLQALLFIGLAASGFNGEGPHIYLGLALFTLILWRIVWGFIGSDTSRF
KQFISSPKRTISYLLGKEPSKAGHNPAGSWMVIGLISTLFIQCITGIALAGLFDHIPYAD
IVLNDNVFDVFVTLHGVCARLLPVLVVLHLVAILFYKLRSKPLVWAMITGVQKKLTEHQM
SSNLVFVSNKRALLVLIATGLVTIAIVVSAGV
Download sequence
Identical sequences Q5DYF6
312309.VF_A1120 WP_011263921.1.21775 WP_011263921.1.76652 YP_207078.1.56684 gi|59714303|ref|YP_207078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]