SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714371|ref|YP_207145.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714371|ref|YP_207145.1|
Domain Number 1 Region: 11-166
Classification Level Classification E-value
Superfamily Resolvase-like 3.92e-31
Family gamma,delta resolvase, catalytic domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|59714371|ref|YP_207145.1|
Domain Number - Region: 181-211
Classification Level Classification E-value
Superfamily TrpR-like 0.00277
Family Trp repressor, TrpR 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59714371|ref|YP_207145.1|
Sequence length 215
Comment resolvease/recombinase [Vibrio fischeri ES114]
Sequence
MYSALLNADIRIYGYLRASTDEQDASRAKNELMLFAEQMGFQVACWFEENESGAQLKRPE
LFRLLDIAISGDVILVEQVDRISRLNTQDWEKLKLMINKKGLKVVSLDLPTSYQFMSNTD
DFTERMLSALNGMMLDMLAAVARKDYEDRRRRQAQGVQRAKLEGKYKGRPINTKLHNKIE
GLLRENKSYSQIENLLGCSRHTISKVSKLIKSSIG
Download sequence
Identical sequences Q5DY89
312309.VF_B0015 APC20891 gi|59714371|ref|YP_207145.1|NC_006842 gi|59714371|ref|YP_207145.1| YP_207145.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]