SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711272|ref|YP_204048.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711272|ref|YP_204048.1|
Domain Number 1 Region: 64-354
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.04e-88
Family N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain 0.000000357
Further Details:      
 
Domain Number 2 Region: 11-63,354-385
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.00000000216
Family N-acetylglucosamine-6-phosphate deacetylase, NagA 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59711272|ref|YP_204048.1|
Sequence length 386
Comment N-acetylglucosamine-6-phosphate deacetylase [Vibrio fischeri ES114]
Sequence
MNSTNAQNNQYMITNVDVFNGQKIEEKQAIIINNDSISSIISMKEADSLTLDRIDGEGAL
ATAGFIDIQLNGCGGVLLNTDIALSTLETMNKTNVKYGTTQYLPTLITSTELDLHNTLSM
MTNFENAEQEGVLGLHLEGPFISIEKKGAHQAQYIRELDLNTAQLLAQHRDQIKVITLAP
EHIKQDVLDCLTAAGITVSIGHTNATYDQVNARTGFTMATHLYNAMTPLGSREPGVVGYI
FDKKPHAGIIVDGIHASYPSVKIAHEQLKEKLFLVTDAVTPAGTDLTEFDMAGTPAYVTD
GKCHYKDGTIAGAAITMIDGVRNLISHVGLSKEEALRMASLYPAQALKIDNEYGQLKENY
KANITLIDSNNDITTTIQMGKLVYQK
Download sequence
Identical sequences Q5E736
312309.VF_0665 WP_011261395.1.76652 YP_204048.1.56684 gi|59711272|ref|YP_204048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]