SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711280|ref|YP_204056.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711280|ref|YP_204056.1|
Domain Number 1 Region: 130-431,480-567
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 3.78e-196
Family alpha-subunit of urease, catalytic domain 0.00000000016
Further Details:      
 
Domain Number 2 Region: 2-177
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 4.32e-63
Family alpha-Subunit of urease 0.00000437
Further Details:      
 
Domain Number 3 Region: 422-477
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.0000285
Family alpha-Subunit of urease 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|59711280|ref|YP_204056.1|
Sequence length 567
Comment urease subunit alpha [Vibrio fischeri ES114]
Sequence
MAHISRTAYANMFGPTTGDRLRLADTELFLEVEKDFTTYGEEVKFGGGKVIRDGMGQSQV
VNSECVDVVITNALILDHWGIVKADIGIKDGRIFGIGKAGNPDVQPNVDIVVGPATEVVA
GEGKIITAGGVDTHIHFICPQQAEEGLTSGVTTFIGGGTGPVAGTNATTVTPGIWNMHRM
LEAVDDLPINVGLFGKGCVSKPEALREQIEAGAMGLKIHEDWGATPAAIHNCLNVADEMD
IQIAIHSDTLNEGGFYEETVKAIGDRVIHVFHTEGAGGGHAPDVIKSVGEPNILPASTNP
TMPYTINTVDEHLDMLMVCHHLDPSIPEDVAFAESRIRRETIAAEDILHDMGAISVMSSD
SQAMGRVGEVIIRTWQCANKMKLQRGILEGDNEHNDNERIKRYVAKYTINPAIAHGISHE
VGSVEKGKLADLVLWNPAFFGVKPALVMKSGLVAYAPMGDINAAIPTPQPVHYRPMFACY
GKAKFKSSMIFLSQASIEAGVPEKLNLQSQIGEVKGCRNISKKSMIHNSYTPNIELDSQT
YEVKADGVPLVCEPATELPMAQRYFLF
Download sequence
Identical sequences A0A1E5ATV6 Q5E728
NYSGRC-FDAO-AAW85168 gi|59711280|ref|YP_204056.1| WP_011261402.1.47877 WP_011261402.1.76652 WP_011261402.1.81434 YP_204056.1.56684 312309.VF_0673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]