SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59711312|ref|YP_204088.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59711312|ref|YP_204088.1|
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.57e-35
Family PurM N-terminal domain-like 0.00035
Further Details:      
 
Domain Number 2 Region: 142-301
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 2.24e-33
Family PurM C-terminal domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59711312|ref|YP_204088.1|
Sequence length 332
Comment thiamin-monophosphate kinase [Vibrio fischeri ES114]
Sequence
MCSEFNLIDRFFVQENVSRDDVDLGIGDDCALVTVPEGYQVAITTDTLAAGTHFLADADP
VSVGHKALASNLSDLAAMGAKPTWVSLALTLPQSDEKWLEGFCKGFFDLAKQYQVELIGG
DTTKGPLSITITVQGIIPKGAALTRSAAQIGDDIYVTGNLGDSAAGLEVILNSHKNVKGE
LEKELEKRHYYSTPQVELAQDIRHLCHAALDISDGVISDLGHILKQSNVSAVINVNNLPI
SSELVTYYRQDKEKCQKLALTSGEEYELCFTASKKNRKAIKQIATILNKKISIIGEIIDK
PFNGLPDSVQLFDNNKLLDWKLLGYDHFRREQ
Download sequence
Identical sequences Q5E6Z6
gi|59711312|ref|YP_204088.1| WP_011261428.1.76652 YP_204088.1.56684 312309.VF_0705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]