SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712083|ref|YP_204859.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712083|ref|YP_204859.1|
Domain Number 1 Region: 21-81,515-556
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 7.2e-24
Family Zn-dependent arginine carboxypeptidase-like 0.078
Further Details:      
 
Domain Number 2 Region: 80-101,215-516
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.95e-21
Family Zn-dependent arginine carboxypeptidase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712083|ref|YP_204859.1|
Sequence length 561
Comment exoenzyme regulatory protein AepA precursor [Vibrio fischeri ES114]
Sequence
MKTFPLSLLAGFLVSPFVLASPDLIFTNGDVITVTGESDRAEAVAIKDGIIVAVGNNQEI
LNQKGTNTQIRDLKGKTLAPGFIDSHGHFAQYLPLIESPFLYPAPMGEVNSFDDIKQIMT
DYFNQPNLDTNSLHVAFGYDDAELKEKQHPTKQFFDTFSKEYPFCAVHISGHLASCNSKG
LDFIGFTKQSTNPDGGVLRRDNNGELTGVLEESAIYPILGNLPEMTQEDAIRRFGKVQDL
YAGYGITTTQEGLATLPALNAMKTMAEQDLLKIDLLAYAKWVDLKEAVKVMPIKSSINGL
TLAGVKMVGDGSPQGKTAYLSTPYFEPPHSHAYDYHGYPVLTQEEMNQWVDTAYQMNAQI
LSHSNGDASADILLNAVELADAKYGKEDRRTVVIHAQTTRLDQIKRMKKNEMIPSFFPTH
TFFWGDWHRDSVLGPWRASNISPMGWANSNDLMFTIHMDAPVLFPDMMTNMWSAVNRVTR
SNQTLGEHHKITPYQALEAITINAAYQNFEEKSKGSIEVGKRADLVILNNNLLDVDPMKI
KDIPILETIKDGKTIYVNQSL
Download sequence
Identical sequences Q5E4S5
312309.VF_1476 VfR170 gi|59712083|ref|YP_204859.1| WP_011262062.1.76652 YP_204859.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]