SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712116|ref|YP_204892.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712116|ref|YP_204892.1|
Domain Number 1 Region: 56-334
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.45e-71
Family Isoaspartyl dipeptidase, catalytic domain 0.0000009
Further Details:      
 
Domain Number 2 Region: 1-55,336-376
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 4.32e-21
Family Isoaspartyl dipeptidase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712116|ref|YP_204892.1|
Sequence length 378
Comment isoaspartyl dipeptidase [Vibrio fischeri ES114]
Sequence
MFILLKNANVYAPQHLGKVNVLIGCGKVISIESDLNVQGIGDISIIDCKGKTVTPGLIDQ
HVHLIGGGGEGGFSSRTPQVTFSKLIQAGTTSVVGVLGTDGISRSPRDLYAKAAALTEEG
ITAYMHTGSYEVPTKTITTSIRDDISFLPSVLGVKIALADHRCSFPTLQELSRIVSDIRI
ASLLAKKRGVLHMHMGALSDPFASVFELLNMGIPISHFSPTHVARTESLFSEAMQFARRG
GYIDITSGGSQFIAPELAIKQAIESGIDPKHITVSSDGNGSLPKFDIDGNMVALTAANVD
GNLLLLPKLIESGISPEIAIAMLTSNVADSLGINKGRLQLGQEADLCIFNDDFTLYGVVA
KGKTVLLDNELLVTGNFE
Download sequence
Identical sequences Q5E4P2
312309.VF_1509 WP_011262089.1.76652 YP_204892.1.56684 gi|59712116|ref|YP_204892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]