SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59712118|ref|YP_204894.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712118|ref|YP_204894.1|
Domain Number 1 Region: 19-326
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.26e-77
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00036
Further Details:      
 
Domain Number 2 Region: 341-551
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.14e-23
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712118|ref|YP_204894.1|
Sequence length 634
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase [Vibrio fischeri ES114]
Sequence
MKKHILTSAILLSLSGYAAAADGDIVDVTILGTSDIHGHFMPWDYASDKLNTKGSLSQIA
TKVKTIRDEQENVILVDAGDTIQGNFVETFKDEPTDPMMLGFNEMKYDIWVLGNHEFDFG
LNVLNRSLTQFKGASLGGNIKRKDGNPFLPAYKIIEKNGIKIGVIGMDTPMTQVFAEGTN
RLEGMTFTNPSLEVKKVIKEIDDKVDAIVLVVHMGLDNENNIEATGVTDIANDNPEIDAI
VAGHMHTRIDKATVNGVIITEPDKYGRALSRIDLQFEEKNGQFTLVNKDSFTYKIKGVES
DEKMEQLYAPYHKRLRENANRVVAELLGVDLVPENEIKGIPQVHIQDTGISALFQEASMH
YAPLANVIALQIDNDMAELNVGKIKAKDIAYNYQYAGGEITVYEMTGKELKTYMEWSAGY
FNSVKEGDVTYSFNLDRRSSKYSTNDFFAGVTYVIDLTKPTGERITDLKFADGRDITNKT
PIRIGMNSYRMGHLTKDGGVLEGRHFPVLFDTEEEFGEEDGTIRNLTIHYLDEVKKGKYE
GKPMSRWTLIGLEGYEKEREIVKALINSGKIDVPKSKDGRYTNVESINVKDKIFSTEAEL
TTYLSKLEQSLDKATTEVEKARIHRDMVIAKALN
Download sequence
Identical sequences Q5E4P0
gi|59712118|ref|YP_204894.1| 312309.VF_1511 WP_011262091.1.76652 YP_204894.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]