SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|59712693|ref|YP_205469.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59712693|ref|YP_205469.1|
Domain Number 1 Region: 30-225
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.64e-47
Family G proteins 0.000000662
Further Details:      
 
Domain Number 2 Region: 201-317
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.28e-40
Family Prokaryotic type KH domain (KH-domain type II) 0.00000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59712693|ref|YP_205469.1|
Sequence length 321
Comment GTP-binding protein Era [Vibrio fischeri ES114]
Sequence
MSDEKEFDLDAYFASEKKSEVSDNQHCGFIAIVGRPNVGKSTLLNQILGQKISITSRKPQ
TTRHRIMGVDTDGDYQAIYVDTPGLHIEEKRAINRLMNRAANSSLSDVNLVLFLVDGTHW
TPDDEMVLNKLKKSEFPTVLLVNKVDNVKDKKDVMTHLQEMTEKMDFVDVVPISAKTGSN
VDVVHKLVREYLPKAVHHFPEEYVTDRSQRFMASEIIREKLMRFTGEELPYSVTVEIERF
DYNPKMDGFHINGLILVERHGQKKMVIGKNGEKIKTIGREARIDMEGLFDRKVYLELWVK
VKSGWADDERALRSLGYIDDL
Download sequence
Identical sequences Q5E315
312309.VF_2086 WP_011262548.1.100783 WP_011262548.1.102040 WP_011262548.1.11820 WP_011262548.1.21836 WP_011262548.1.23113 WP_011262548.1.34959 WP_011262548.1.66091 WP_011262548.1.76652 WP_011262548.1.77059 WP_011262548.1.80135 WP_011262548.1.82276 WP_011262548.1.94618 YP_205469.1.56684 gi|59712693|ref|YP_205469.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]