SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714009|ref|YP_206784.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714009|ref|YP_206784.1|
Domain Number 1 Region: 4-251
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 9.42e-45
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59714009|ref|YP_206784.1|
Sequence length 277
Comment ferric anguibactin transport system permease protein FatD [Vibrio fischeri ES114]
Sequence
MKKLLLVLIVLSFASVFIGVADLPLSAIFRGDTEALELLMVSRLPRLLAILLSGAGLSIA
GLIMQQISQNRFAAPSTSGTIECAMLGYVLSLVLFGHGDNLLLIFAMAIGGTLLFIQFIH
RIQFKNAIYVPLIGIIFGNVVSSAATFVAYKYDAVQNLSAWTVANFANILQGNYELLYIA
IPISVISYWYATRLSAVGMGKDFAINIGLNYKQILFLGIILVSVMSATVVMIVGQLPFLG
LIVPNLVAQFYVYFFLIYSTTANTENNTFFISYLYDH
Download sequence
Identical sequences Q5DZA0
312309.VF_A0826 YP_206784.1.56684 gi|59714009|ref|YP_206784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]