SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714047|ref|YP_206822.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714047|ref|YP_206822.1|
Domain Number 1 Region: 113-243
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.49e-31
Family Reductases 0.06
Further Details:      
 
Domain Number 2 Region: 3-108
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.7e-27
Family Ferredoxin reductase FAD-binding domain-like 0.0021
Further Details:      
 
Domain Number 3 Region: 232-342
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.1e-23
Family 2Fe-2S ferredoxin-related 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59714047|ref|YP_206822.1|
Sequence length 343
Comment HCP oxidoreductase, NADH-dependent [Vibrio fischeri ES114]
Sequence
MTQFIWPTTPVQLRCDKKWQETDDTISLQLISEHKETFDFKPGQFVSIGIEIEGKMEYRA
YSISSVPNQDFLQLTIKRVEGGKVSNYLIDQLNEGDEVAVLAPTGPFNSIDCKPRKKVAL
LSAGCGITPVMSMAKSWIAQNKDIDITFIHMEKSPEHTIYFDELQYLNKQHANFNLKLLL
KNPQFTDYPQGRLDQEWLVTLCPDLVERTVFLCGPTNFMQDMKKYVEAIGLDMAHFFQES
FTPIEPEIMETVENSGVVQFDVPAFGVSKEIDKGATLADVLEESGVPIIIACRSGMCGSC
KCKVTKGDVSRTSTETLSEEDIAQGYTLACSSQVQSDVEVSLV
Download sequence
Identical sequences Q5DZ62
gi|59714047|ref|YP_206822.1| WP_011263681.1.76652 YP_206822.1.56684 312309.VF_A0864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]