SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714100|ref|YP_206875.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714100|ref|YP_206875.1|
Domain Number 1 Region: 8-141
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.12e-31
Family Deoxycytidylate deaminase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59714100|ref|YP_206875.1|
Sequence length 147
Comment deoxycytidylate deaminase [Vibrio fischeri ES114]
Sequence
MISKWAKRFFQMAELVGSWSKDPSTQVGAVITKHNRIVSVGFNGYPHGVSDSADTDEREI
KYLKTLHAEENAILFAKRDLEGCDIWVTHFPCPNCAAKIIQTGISKVYCPEQTEDFLSRW
GEKIQVSQDMFSQAGVEVTWLPLDTLK
Download sequence
Identical sequences A0A1B9P725 B5EV65 Q5DZ09
WP_011263737.1.100783 WP_011263737.1.102040 WP_011263737.1.11820 WP_011263737.1.198 WP_011263737.1.21686 WP_011263737.1.21775 WP_011263737.1.21836 WP_011263737.1.32349 WP_011263737.1.34024 WP_011263737.1.3463 WP_011263737.1.34959 WP_011263737.1.44395 WP_011263737.1.47877 WP_011263737.1.66091 WP_011263737.1.76599 WP_011263737.1.76652 WP_011263737.1.77059 WP_011263737.1.80135 WP_011263737.1.81434 WP_011263737.1.82276 WP_011263737.1.85856 WP_011263737.1.93430 WP_011263737.1.94618 WP_011263737.1.97281 YP_206875.1.56684 gi|197337866|ref|YP_002158583.1| 312309.VF_A0917 388396.VFMJ11_A1035 gi|59714100|ref|YP_206875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]