SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714152|ref|YP_206927.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714152|ref|YP_206927.1|
Domain Number 1 Region: 71-390
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 6.49e-81
Family SAH/MTA deaminase-like 0.0000017
Further Details:      
 
Domain Number 2 Region: 363-448
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.00000000019
Family SAH/MTA deaminase-like 0.014
Further Details:      
 
Weak hits

Sequence:  gi|59714152|ref|YP_206927.1|
Domain Number - Region: 9-97
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.00186
Family N-acetylglucosamine-6-phosphate deacetylase, NagA 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|59714152|ref|YP_206927.1|
Sequence length 448
Comment guanine deaminase [Vibrio fischeri ES114]
Sequence
MNIKKGVVGKVYHCPIKGEFEFISNGLITIDQQGKICDVLHPSDPNYSKTLNFLKEKDSL
QELTEQQFLLPGMVDLHIHAPQWPQAGKGLDLPLNEWLDHYTFPLEHKFSDLSFAEQYYP
HLVKTYLANGTTTATYFATIDTSSSLYLAETCIKYGQRALVGKVSMDDKEMCPNYYVEES
AEHSIQEAERFITSFSQLANNNNLVEPIITPRFIPTCSLEALKGLGDLAKKYQCAVQTHA
SESDWARDFSQEKYNKTDIEIYNEAGLLGERTILAHSIFLTDSDIDTIKQKGSGIAHCPR
SNIYFANAALPLREYLDQDIQLGLGSDIAGGPFPSLFMACSDAVLHSRARECGTNASLPA
EIRGQKNSRVSLLEAYWMATTGGGQLLKLPVGQFKKGYCFDALVIDDEDSNLLICPDLDS
PQDILEKIITHTTRNNIRQVWVDGNQVK
Download sequence
Identical sequences Q5DYV7
WP_011263785.1.76652 YP_206927.1.56684 312309.VF_A0969 gi|59714152|ref|YP_206927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]