SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|59714182|ref|YP_206957.1| from Vibrio fischeri ES114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|59714182|ref|YP_206957.1|
Domain Number 1 Region: 53-350
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 7.78e-94
Family N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain 0.00000343
Further Details:      
 
Domain Number 2 Region: 1-52,350-380
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000000000000199
Family N-acetylglucosamine-6-phosphate deacetylase, NagA 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|59714182|ref|YP_206957.1|
Sequence length 380
Comment N-acetylglucosamine-6-phosphate deacetylase [Vibrio fischeri ES114]
Sequence
MRYALYPQRVFVADGIKEHHYVIVNDGKIEAITACEPTDCEILPLEGKTLLPGFIDIHIH
GRAGADVMDATPEALQTISDALLQTGVVAWVGTTVTAPWDSIVSSIDTVKTWLDKPQQCG
AELLGSFLEGPYFTEVHRGSHPTAYLKSPSIQELEELYDVAAHSLLRVAIAPEADGAMEA
IQWLQSQNIKTSVAHTDSTFEQVTQAHQLGADCGVHLFNGMRGLHHREPGCTGAVLYHDM
LAELIADSVHVHPVMMQLAYRMKGYQQIALITDCMRAGGLEDGEYQLGAQTITVAKGEAR
TKCGSLAGSTCSLDSALRNMIQLSEVPEWEAVQMATLVPAKYLGIDDRLGSIAPEMEASF
VVVNQDFAVQNTMIKGEWVY
Download sequence
Identical sequences Q5DYS7
312309.VF_A0999 gi|59714182|ref|YP_206957.1| WP_011263812.1.76652 YP_206957.1.56684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]