SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Chlvu1|83613|estExt_fgeneshCV_pg.C_130082 from Chlorella vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Chlvu1|83613|estExt_fgeneshCV_pg.C_130082
Domain Number 1 Region: 350-420
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000327
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0025
Further Details:      
 
Domain Number 2 Region: 268-346
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000107
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0058
Further Details:      
 
Domain Number 3 Region: 426-519
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000128
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Chlvu1|83613|estExt_fgeneshCV_pg.C_130082
Sequence length 634
Sequence
MSAHHFYQTLDGGCTKHCAPQLVTLRNFRVPLFHSTRKCQQHAAQALQKQGFRKASRRRQ
LSVLSCSGNPAAGAARPAANGDPRKPTTAGKQAPEAAAPSRDSSAVSSNDPPAQSSSQQA
EQQGSLTGLKPFHVAAFAAILACGLAFLAVLLYITADMQFQRACIKVVKRLLKTVALRQV
MGILAAMTFVRFGLEPLVKVLRGIFSAQGSWEKSSEYYILREVYRPLEFLFSVAAFTTLA
ENFLPQLISIPKAMVQNLVRSTLSLTFVIAAARVVFNVKARMTREATWQLELKGDLTKQR
RVEAVDKLLSVLTLLVASVFGLQAIGLDVNSVLAIGGVGGLAVGLAGREILENLFTGLII
LSSSPFEVGDEVLFSPPSGQVVEGIVVDVGWYRTTIRSFEREIFNIPNSVFSRNVVLNIT
RKQREWRFYEFIGLRVDDVGKASAVVADMRKIIRQDPRIIQKLHRRVFFDKLTREQVTIY
VSFYVEAANRDAFMSIKQDLLLAFIDCVDRNGAKLAKQRLEVEVAPSQMAASSQRPASSG
VNDGAASSQKALPEGKAGSQQAPVDVSLTPPGTSSSSGSSAAPETERAGTSSNVVPSTDP
LRSAVAAASGLVVADNMSSDEQPGSMMTASFDVL
Download sequence
Identical sequences I0YS08
jgi|Chlvu1|83613|estExt_fgeneshCV_pg.C_130082 XP_005645721.1.71052 jgi|Coc_C169_1|48305|estExt_fgenesh1_pg.C_130148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]