SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Chlvu1|35977|estExt_Genewise1.C_30592 from Chlorella vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Chlvu1|35977|estExt_Genewise1.C_30592
Domain Number 1 Region: 457-577
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000133
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Chlvu1|35977|estExt_Genewise1.C_30592
Sequence length 617
Sequence
MVGWLRTYKIKQYLLPDILAGASVAALVVPQGMSYAGLAGLPAVYGLYGAFVPVLCYAAL
GSSRHLAVGPVAVTSLLLGSGIPNIIDAPIQDNPNNPRNQHAQDVYNHAAIQVAFLAGCL
YTAVGILELGWLTNFLSHSVISGFMSGASVIIALSQLPQISFPRHDPVQEQLKDLFGPTW
TPYWQWREFLMGACWLILLFTMKEVGKRNKRLVYVRAAGPLTVTVLSIAISNIFKLYQAP
YNIKTVGVVPAGLPHQTVTWWFPFHDIGRFIGLAIKVCAIDVLESISIAKALAYRNQYEL
NATQELRGLGLANLVGAAFNCYTTTGSFSRSAIMNDVGAKTQLAGITSGVIVMIVLLCLT
PVFRNMPQNAQGAVIIAAVVGLFNYEEWWFLLRVNFLDWVVFNVALLTTMFAGVDLGLGI
SIGLSIVLALYKSAFPKTSVLGQLPETSVFRNVKQYPEAREVEGMLLLRVDAPLYFANVN
PVKDALYKYERRAKEIAAAQGRSLHFIIIDLSPVNDIDASAVHFFKDWVISHKRAGIQPV
ISNPSRQIMRLLEKAHIPEIIGEEYITVRMADAVAVCQEILAELGAHKTTVAQELKRESE
ATRPKVEPSFSVTEKLV
Download sequence
Identical sequences jgi|Chlvu1|35977|estExt_Genewise1.C_30592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]