SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Chlvu1|71976|fgeneshCV_pg.C_scaffold_4000078 from Chlorella vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Chlvu1|71976|fgeneshCV_pg.C_scaffold_4000078
Domain Number 1 Region: 6-275
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.68e-37
Family Acetyl-CoA synthetase-like 0.00084
Further Details:      
 
Domain Number 2 Region: 565-711
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000212
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number 3 Region: 395-467
Classification Level Classification E-value
Superfamily ACP-like 0.00000302
Family Peptidyl carrier domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Chlvu1|71976|fgeneshCV_pg.C_scaffold_4000078
Sequence length 733
Sequence
MALLRELDEAFRQRPHQAVFVQQPCDNKEDWTYECLRQKVTELSGLICQTLGAATAASDG
GQPPIVGLYLDTSIAYVIGVLATLRARAAFMPLDARWPPSKLTAVLDDARPAVILWADKA
CNGCGPVAHDRCPLLQIPSTLLDPANPADIREGQTAGAEVGTHLQENGMSEQADAPSIAY
VMHTSGSTGIVNRFRWMQRAHPFKAGDVACFHTAPTFVDSIWQIFGPLLGGVPLLVLPPS
ASHDLSALFKALQQQNVTHFVSVPTVLAALLRYMDFTGQQGISTETVPVGWPLDNMAVFI
AAPVGDGGGHSSEEGAVTSMSASEVLDLGEEGEGSGSIRWRLRPVWRRILGWWQQLPLSG
LQDPSMLGGISHPEDGAQAALPHGFPFAGPGGLEAAAMRAFSAALGLPSRALEPGTDFWS
AGGDSLSAAQVAGWLGVDVRMLTAFPTARTLAAQLRAMRATNSTPNLDSQEKPSRAAAPS
SAALESRPLQDALHEQLRKRRRVSAREPDQAPGRADWTLTPPSPALGGMVLQRGGHAALE
QAGKHSGWEREGSRQLREQQLRWFVLGCSHGGDVVCIDGPSGTPLWRSTIGGRAESGLTL
TGDLQHVAVAQSEGRLCFLRTADGVEVGSCETGGALRAAPVTDPWLGYIWAASHGRQLNI
CRAPGEVILRQDVGSAVSASVAFHAASRRAYLCALDGTLSAWDFSLGPQEHIAFPDPDHL
AAFVIWNMRLDKM
Download sequence
Identical sequences jgi|Chlvu1|71976|fgeneshCV_pg.C_scaffold_4000078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]