SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34498771|ref|NP_902986.1| from Chromobacterium violaceum ATCC 12472

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34498771|ref|NP_902986.1|
Domain Number 1 Region: 150-464,580-610
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-77
Family Type II chitinase 0.0000733
Further Details:      
 
Domain Number 2 Region: 41-99
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 4.32e-16
Family Carbohydrate binding domain 0.0025
Further Details:      
 
Domain Number 3 Region: 464-578
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000671
Family Chitinase insertion domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|34498771|ref|NP_902986.1|
Sequence length 791
Comment chitinase [Chromobacterium violaceum ATCC 12472]
Sequence
MSKTLMLVKSGLAAGAMGGVALVAGTAQNVAPPPAALAPSYLVKTADSSCADPAWNAAAV
YTGGQRVSYQNQTWQAKWWTQGNTPAAGDASPWQLIGQCGGGTPSDPPLVQVPPPTGNAL
CRPEALAQTQGVDVPYCAVYKQGGAEQLANGSRRRIIGYFTSWRTGKDGSPAYLASDIPW
SKLTHINYAFAHVDGSNKLSVNETAPGNPATDMSWPGVAGAEMDASLPYKGHFNLLTQYK
RKYPGVKTLISVGGWAETGGYFDANGKRVASGGFYSMTVNADGTVNQAGINAFSDSAVAF
LRKYGFDGVDIDFEYPTSMNNAGNPLDWTFSNARLGSLNKGYVALLQTLRDRLDRAAAQD
GRYYQITAAVPASGYLLRGMETFQGLKYLDFVNVMSYDLHGAWNRFVGPNAALYDDGKDA
ELAFWNVYSTPQYGNIGYLNTDWAYHYYRGGLPASRVNMGVPYYTRGWKNVSGGSNGLWG
SSVGSNCPAGLTECGDGAVGIDNIWHDLDDSGKEIPGGSNPMWHAKNLEKGLAGSYLAAY
GIDPTLPINQLTGSYQRNYNGALAAPWLWNAGKKVFLSTEDEQSIAQKAAWIDANNVGGV
MFWELAGDYDWKAQRNNGQGEYFIGTTLTSLLYNTFSQPPKVSARRADAAPAPTAAIDVG
FSLGGFKLGDQNYPINPKLTIVNRSQTTLPGGTEFQFDVPTSAPANIADQSGFGLKVVSA
GHSGSNVGGLKGDFNRVSVKLPSWQSLGAGQSVTLDVVYYLPISGPSHYTVGLNGKTYAI
RDEAPYLPYLR
Download sequence
Identical sequences Q7NSV3
243365.CV_3316 CvR87 gi|34498771|ref|NP_902986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]