SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34499028|ref|NP_903243.1| from Chromobacterium violaceum ATCC 12472

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34499028|ref|NP_903243.1|
Domain Number 1 Region: 120-285
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.76e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00066
Further Details:      
 
Domain Number 2 Region: 407-548
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.01e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.74e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.027
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.74e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|34499028|ref|NP_903243.1|
Sequence length 552
Comment sulfite reductase hemoprotein subunit beta [Chromobacterium violaceum ATCC 12472]
Sequence
MYRYDEVDHRLVRERVVQFRDQTRRFLAGELSEDEFRPLRLMNGLYIQRHAPMLRVAIPY
GHLRSEQLRKLADIARRYDKGYGHFTTRQNIQFNWPELDKVPDILEELSTVEMHAIQTSG
NCVRNTTTDAFAGVAADQLFDPRPYCEIIRQWSTMHPEFSFLPRKFKIAVSGSIEDRAAT
MVHDIGLHVSRNETGEAGFKVIVGGGLGRTPMVGEVIREFLPRQHLLTYLDAVLRVYNRF
GRRDNKYKARIKILVKAMTRDGFAAKVEDEWSHLKDGPATLRDEDVAHYASFFADPDYPA
LADDPAELTGPLAEDKAFARWFERNTRAHRRPGYRSVVLSLKESGAPPGDITSEQMEAAA
DWADRFGFGELRVAHEQNLVLPDVAQKDLYALWQAARSQRMATPNIGLLTDIISCPGGDF
CSLANARSIPVANAIQQTFDDLDYLYDLGDIACNFSGCMNACGHHHIGNIGILGVDKNGE
EWYQITLGGSQGSDTTIGKVIGPSFAQADVPVAFSKIMQVYIERRLDGERFIETLRRIGA
EPFKERVYAPVH
Download sequence
Identical sequences Q7NS53
243365.CV_3573 WP_011137120.1.12997 WP_011137120.1.42720 WP_011137120.1.48671 WP_011137120.1.50066 WP_011137120.1.71623 gi|34499028|ref|NP_903243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]