SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34499359|ref|NP_903574.1| from Chromobacterium violaceum ATCC 12472

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34499359|ref|NP_903574.1|
Domain Number 1 Region: 249-381
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 1.16e-28
Family Cell-division protein ZipA, C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|34499359|ref|NP_903574.1|
Sequence length 398
Comment hypothetical protein CV_3904 [Chromobacterium violaceum ATCC 12472]
Sequence
MSELQIGVLILGGGVIALVVGFNVFQEWRFRKRTQQAFARAHDDVLLDVPKNNVRDGVRA
DRMEPVLVDAELEPEDDALAFEPQFPEQAPVAREPAAHPARQEPAAPQFDVPVIDEEDEA
ELAMDSADHQALVVAMLDPSLDFIAEVVFHEPHELAAMPRFNVGKRTQLIGRTERGLWKV
AEALPGTRYKQINVSMQMVDRSGAVTEQELAAFCQQVSRFAEDHDAAVSFPQRQQKLVAA
RELDRFCADVDVLIGINIVPRSAIEGARLRSFAEAAGLQLEPDGAFHYLADSGNTLYSLV
AADQMPFTFHTLLDKSFPALTLLFDVPRVAGGVDVFDRAVHFARQLAQEFDAQLVDDNRR
VLSETGLARIRDQLLHIYGSMDDRGIAPGSVAALRLFA
Download sequence
Identical sequences A0A202B4U0 Q7NR80
gi|34499359|ref|NP_903574.1| WP_011137451.1.47683 WP_011137451.1.48671 243365.CV_3904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]