SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|431809761|ref|YP_007236652.1| from NCBI viral sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|431809761|ref|YP_007236652.1|
Domain Number - Region: 69-120
Classification Level Classification E-value
Superfamily Replisome organizer (g39p helicase loader/inhibitor protein) 0.0222
Family Replisome organizer (g39p helicase loader/inhibitor protein) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431809761|ref|YP_007236652.1|
Sequence length 148
Comment hypothetical protein [Staphylococcus phage StB20]
Sequence
MNLGKEDIPKLEQFFRNYEDMKGQLLYRRYELLYQPQDTNTGGGKSNLPSSPVENEVTKL
HSDLKYNNLQAIIQAIEDVYKNATQEQKLIVDYRYWEKDLTVYEWPDIAHELTKAREDNK
VISRDATLRMRNQLMRETAKRIGWVSFD
Download sequence
Identical sequences H9A107
gi|431809761|ref|YP_007236652.1| WP_016064941.1.1613 WP_016064941.1.24363 YP_007236652.1.31766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]