SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384449214|ref|YP_005661816.1| from Chlamydophila pneumoniae LPCoLN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384449214|ref|YP_005661816.1|
Domain Number 1 Region: 12-307
Classification Level Classification E-value
Superfamily SIS domain 2.67e-48
Family mono-SIS domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384449214|ref|YP_005661816.1|
Sequence length 329
Comment sugar isomerase, KpsF/GutQ family [Chlamydophila pneumoniae LPCoLN]
Sequence
MPSPMISTDVCQDILGKQKEAVDFFFQAFQPKEAMQLAEKILGHSGWVFFSGVGKSGCVA
RKLVATLQSLSERALFFSPVDLLHGDLGLVSPGDIVCLFSKSGETQELLDTVPHLKSRGA
ILVAITSMPYSNLAALSDLVVILPSVAELDPFNLIPTNSTTCQMIFGDFLAMLLFHSRGV
SLSTYGKNHPSGQVGMKANGKVKDFMFPKTEVPFCHLGDKVSFSLEVFSAYGCGCVCIVD
PQFRLMGIFTDGDLRRSLASYGGEVLSLSLDKVMTANPRCITEDSDIAIALQLMESSSPV
AVLPVLDNEENRHVTGLLHMHTLAKAGLL
Download sequence
Identical sequences WP_014517631.1.100378 gi|384449214|ref|YP_005661816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]