SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189351189|ref|YP_001946817.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189351189|ref|YP_001946817.1|
Domain Number 1 Region: 93-143,302-386
Classification Level Classification E-value
Superfamily TPR-like 0.00000000141
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189351189|ref|YP_001946817.1|
Sequence length 395
Comment HemY protein [Burkholderia multivorans ATCC 17616]
Sequence
MTLRGIVWLAVLFAIAVALATVGRFDAGQVLIVYPPYRVDVSLNLFVISVVVLFIVVYAL
LRIVRNIWRMPQRVAAYRARTRNEKAQASLRDAIANLYAGRFSRAEKAAREALAVDANQG
AASLVAATAAHRMHEYTRRDEWLSKVDAPEWQDARLLATADMRADARDADGALAALADLQ
AGGKRIHAQQVALRAQQQLKNWAEVLKLAKALEKREALHPAAAVRLRQQAAENLLRERRH
DADALLEIWQSLSPAERQSPRLADLAAELLVALERRTEARRIVEDALAHNWDARLLRRYP
DTAGADALPLIQKAEGWKKDHPEDADLLFALGRLCQQQQLWGKAQSFLEAALKLADNEAL
KVRAHRALARLFEHLGETDKAAKHYRESALAITVV
Download sequence
Identical sequences A0A0H3KGL2 A0A1B4MW70 B9BQW8
gi|189351189|ref|YP_001946817.1| WP_006405813.1.100558 WP_006405813.1.24798 WP_006405813.1.24872 WP_006405813.1.26607 WP_006405813.1.37770 WP_006405813.1.4927 WP_006405813.1.52658 WP_006405813.1.54573 WP_006405813.1.58278 WP_006405813.1.60128 WP_006405813.1.67959 WP_006405813.1.73018 WP_006405813.1.74059 WP_006405813.1.84428 gi|189351189|ref|YP_001946817.1| 395019.Bmul_0871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]