SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189352150|ref|YP_001947777.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189352150|ref|YP_001947777.1|
Domain Number 1 Region: 377-854
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.22e-147
Family Aconitase iron-sulfur domain 0.000000000000478
Further Details:      
 
Domain Number 2 Region: 162-370
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 2.35e-67
Family LeuD-like 0.000000035
Further Details:      
 
Domain Number 3 Region: 1-160
Classification Level Classification E-value
Superfamily Aconitase B, N-terminal domain 1.7e-66
Family Aconitase B, N-terminal domain 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189352150|ref|YP_001947777.1|
Sequence length 861
Comment bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase [Burkholderia multivorans ATCC 17616]
Sequence
MLENFRAHVAARAALGIPPLPLTAQQTAELVELLTNPPAGEEQTLLDLITHRVPAGVDEA
ARVKAGFLAAVAKGETACPLISRARATELLGTMLGGYNIQPLIELLSDAEVGAVAADALK
KTLLMFDQFHDVKELADKGNANAKAVMQSWADAEWFTSRPEVPESLTVTVFKVPGETNTD
DLSPAPDATTRPDIPLHALAMLKNARPGITPEEDGKRGPVKFIESLKEKGHLVAYVGDVV
GTGSSRKSATNSVLWFTGQDIPYVPNKRFGGVCLGGKIAPIFYNTMEDAGALPIELDVSK
MEMGDVIELRPYEGKALKNGEVIAEFQVKSDVLFDEVRAGGRIPLIIGRGLTAKAREALG
LPPSTLFRLPHQPADSGKGFTLAQKMVGRACGLPEGKGVRPGTYCEPKMTSVGSQDTTGP
MTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVKTHQTLPNFISTRGGISLRPGDGVI
HSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGTMPLDMPESVLVRFKGK
MQPGVTLRDLVNAIPLYAIKQGMLTVAKQGKKNIFSGRILEIEGLPDLKVEQAFELSDAS
AERSAAGCTVRLNKEPIIEYLNSNITLLKWMIAQGYQDARSLQRRIAAMEQWLADPKLLE
PDADAEYAAVIEIDLADIHEPIVACPNDPDDVKTLSDVAGAKIDEVFIGSCMTNIGHFRA
ASKLLEGKRDIPVKLWVAPPTKMDQKQLTEEGHYGVFGTAGARTEMPGCSLCMGNQAQVR
EGATVMSTSTRNFPNRLGKNTNVYLGSAELAAICSRLGRIPTKEEYMADIGVINANGDKI
YKYMNFDQIEDFKEVADTVQV
Download sequence
Identical sequences A0A0H3KJL7 A0A1B4N3U0 B9B1J0 B9BL35 J5B5N0
395019.Bmul_5149 gi|189352150|ref|YP_001947777.1| WP_006397781.1.100558 WP_006397781.1.101207 WP_006397781.1.11863 WP_006397781.1.17778 WP_006397781.1.19915 WP_006397781.1.23373 WP_006397781.1.23823 WP_006397781.1.24798 WP_006397781.1.24872 WP_006397781.1.25176 WP_006397781.1.26607 WP_006397781.1.37770 WP_006397781.1.38187 WP_006397781.1.42270 WP_006397781.1.43525 WP_006397781.1.4927 WP_006397781.1.49281 WP_006397781.1.51269 WP_006397781.1.52658 WP_006397781.1.54573 WP_006397781.1.55135 WP_006397781.1.58278 WP_006397781.1.60128 WP_006397781.1.60510 WP_006397781.1.66697 WP_006397781.1.67959 WP_006397781.1.7115 WP_006397781.1.73018 WP_006397781.1.74059 WP_006397781.1.78867 WP_006397781.1.8115 WP_006397781.1.81730 WP_006397781.1.82554 WP_006397781.1.84428 WP_006397781.1.95489 gi|189352150|ref|YP_001947777.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]