SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189353663|ref|YP_001949290.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189353663|ref|YP_001949290.1|
Domain Number 1 Region: 10-303
Classification Level Classification E-value
Superfamily FMN-binding split barrel 9.02e-79
Family UbiD middle domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 310-455
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 7.98e-39
Family UbiD C-terminal domain-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189353663|ref|YP_001949290.1|
Sequence length 464
Comment decarboxylase [Burkholderia multivorans ATCC 17616]
Sequence
MASSPFAEQQDFHHFANAYRAHYPDDVLAIAQPLSADQDVTAVVASLAARGRHDMLVCER
VDGLAVPLVTNVFASRTRIARLFGVDAHDLFDAWQRRANAPIAPVVVPHGPVLDHVLEGD
AVDLAQLPMIRHFETDRGPYVTNAVIVAEDPETGIANLSYHRSMRAARNALATSLHSRGH
LWRMLHAAKSRGDTLKVAMVIGAHPLFMLAAAARVPFGVDERAIAGGLFGAPLQLVRTPR
YGIGVPAAAEFVLEGTIDPDAHAEEGPFGEFTGYSSDRSTNNVLRVDTMMRRRDAWLVDV
VGGPYAEHLTLARLPREAEMSEKLKARFPAVTAIHYPNSGTHFHCYVALKQTRDGEARQI
MLALLGWDPYLKNVVAVDSDVDITDDAQVLWAIATHFQPHRDLFVVDGLPGSPLDPSSSA
DGTTSRMGLDATRGARFDGVRARVGDAAMQRVAQLVAQLDGAAR
Download sequence
Identical sequences A0A0H3KWI5
WP_012216502.1.54573 WP_012216502.1.74059 gi|189353663|ref|YP_001949290.1| 395019.Bmul_3609 gi|189353663|ref|YP_001949290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]