SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|189354080|ref|YP_001949707.1| from Burkholderia multivorans ATCC 17616

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189354080|ref|YP_001949707.1|
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.1e-49
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|189354080|ref|YP_001949707.1|
Sequence length 334
Comment chemotaxis family response regulator [Burkholderia multivorans ATCC 17616]
Sequence
MDHRDVVVVASSRGGLPVLRTLVTNLPEGFPVPICIVQHIGRNRSILPELLTRWGRLDAT
HALHGERPHPGRIYVAPPDRHLVLRGGRLHLLDTAAENYARPAADPLFRSAAREYGPGAI
GVVLSGDLDDGSAGLAAIRAHGGYGIVQRPDECEAPSMPRAALAAAGADAVATADELART
IHAAVYGARGEEGRTMTDLRTLDDESRIAEGRFVTPQLLDAIGERSALTCPSCNGALWRM
RDDRPLRYRCHTGHAFSALSLDDAEAQKAEDAIWVAIRAVNERMIFARERQEWARRTGNA
EDEAIEQARIDENRQLAEVLRHALHVATHGRETG
Download sequence
Identical sequences A0A0H3KQ23
395019.Bmul_3192 gi|189354080|ref|YP_001949707.1| WP_012216206.1.17778 WP_012216206.1.23373 WP_012216206.1.23823 WP_012216206.1.25176 WP_012216206.1.38686 WP_012216206.1.42384 WP_012216206.1.54573 WP_012216206.1.66141 WP_012216206.1.66697 WP_012216206.1.74059 WP_012216206.1.78867 gi|189354080|ref|YP_001949707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]