SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384438838|ref|YP_005653562.1| from Thermus sp. CCB_US3_UF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384438838|ref|YP_005653562.1|
Domain Number 1 Region: 38-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.04e-67
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384438838|ref|YP_005653562.1|
Sequence length 307
Comment Proline dehydrogenase/delta-1-pyrroline-5-carboxylate dehydrogenase [Thermus sp. CCB_US3_UF1]
Sequence
MNLDLLYRQAVLSVAGNPRVEGLIKTRARSLVRRYVAGESLEEALRAAEGLERQGVHAIL
DLLGEMVRSEAEARAFQAGILELVRRVAERPWPKYVSLKPTQLGLDLSEGLALELLREIL
REAEPRGVFVRMDMEDSPRVEATLRLYRALREEGFSGVGIVLQSYLFRTEKDLLDLLPYR
PNLRLVKGAYREPKEVAFQDKRLIDAQFLHLGKLALREGLYVAFATHDPRLIAEVKRYAE
AMGFPKTAFEFQLLYGVRPEEQRRLAQEGYTVRAYVPYGRDWYPYLSRRIAERPENLFLV
LRSLLGG
Download sequence
Identical sequences G8N9J0
WP_014514851.1.31984 gi|384438838|ref|YP_005653562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]