SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384439742|ref|YP_005654466.1| from Thermus sp. CCB_US3_UF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384439742|ref|YP_005654466.1|
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.88e-21
Family Siroheme synthase N-terminal domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 114-186
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 3.92e-18
Family Siroheme synthase middle domains-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384439742|ref|YP_005654466.1|
Sequence length 214
Comment Uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase [Thermus sp. CCB_US3_UF1]
Sequence
MGYFPLMLDLRGKPVLLVGGGPETPQKLRALLEAGAEVTVLAQEDPGDLEALAQEGRIRW
VRRGYRRGDLEGFFLVVSHPKDKAIHPEVRREAEERRIFLVAVDDPENASAILPAVLRRG
ELVVALSTSGAAPALAVRLKERFAALLPLAYGELVAYLRTLRPRIAQIPDFEARKRLWYR
IVDQALEALDLDPKEGLPKAMAKAEAALEEVWTR
Download sequence
Identical sequences G8NDZ1
gi|384439742|ref|YP_005654466.1| WP_014515749.1.31984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]