SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384440309|ref|YP_005655033.1| from Thermus sp. CCB_US3_UF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384440309|ref|YP_005655033.1|
Domain Number 1 Region: 19-173
Classification Level Classification E-value
Superfamily Folate-binding domain 1.27e-24
Family Aminomethyltransferase folate-binding domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384440309|ref|YP_005655033.1|
Sequence length 256
Comment aminomethyltransferase [Thermus sp. CCB_US3_UF1]
Sequence
MEDALENLRSGRGYFAFQGLLLLRGPDALSFLQGQCTRDLRRLEGPKGALFLNHKGQIEE
AATLFPHPEGFLLSPWGSLEGLKARLRRYIVFDQVEIAQLPLFRLLHLDGREEVAESGEG
ALDPGLYPLYTLLRGLPLLADIRGELPQSVGLLPLVDYGKGCYVGQEIMARLEGKEVHHH
LVGLRALEPGGEAPFPLTWQGQKAGEAKRFLPTPFGLLGLGVVRKEVPFGALVEGGGGRF
RLEPLPFKEAGWSGQR
Download sequence
Identical sequences G8NAS2
WP_014516308.1.31984 gi|384440309|ref|YP_005655033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]