SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384440604|ref|YP_005655328.1| from Thermus sp. CCB_US3_UF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384440604|ref|YP_005655328.1|
Domain Number 1 Region: 79-211
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.96e-48
Family Molybdopterin synthase subunit MoaE 0.0000603
Further Details:      
 
Domain Number 2 Region: 2-73
Classification Level Classification E-value
Superfamily MoaD/ThiS 0.0000000000000243
Family MoaD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384440604|ref|YP_005655328.1|
Sequence length 219
Comment Molybdenum cofactor biosynthesis protein D/E [Thermus sp. CCB_US3_UF1]
Sequence
MRLFALYREKAGQDRLLLELPEGARVREAQAALERLFPGLELRGGMAAVNQALATGETPL
KEGDELAFLPPVSGGQDSYGLTENPLDLKALVGWATAPEYGAVVSFLGTTRSPNRGEEVA
FLEYEAYPGMAEKVMAQIIGEMRARWPLGRVALWHRLGRVDPGEASIAIVVSARHRKEAF
AACEYAIDRVKQILPVWKKEHRQDGSFWVEGFTPEGHTL
Download sequence
Identical sequences G8NCI7
gi|384440604|ref|YP_005655328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]