SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001296 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001296
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.05e-38
Family Ribosomal protein L20 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001296   Gene: ENSPCAG00000001425   Transcript: ENSPCAT00000001380
Sequence length 149
Comment pep:known_by_projection scaffold:proCap1:scaffold_25030:16461:20262:-1 gene:ENSPCAG00000001425 transcript:ENSPCAT00000001380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLTTQLWLRNRVTDRYWRIQEVLKHARHFRGRKNRCYRLAVRAVIRAFVKCTKARRLK
KRNMRTLWISRITAASEEHGLKYPAFISNLIKCQVELNRKVLADLAIYEPKTFKSLAALA
KRRREEGFAAALGDGKEPEGVFSRVVHYR
Download sequence
Identical sequences ENSPCAP00000001296 ENSPCAP00000001296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]