SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008192 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008192
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily E set domains 1.08e-40
Family RhoGDI-like 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008192   Gene: ENSPCAG00000008820   Transcript: ENSPCAT00000008767
Sequence length 134
Comment pep:known_by_projection scaffold:proCap1:scaffold_117838:6114:6831:1 gene:ENSPCAG00000008820 transcript:ENSPCAT00000008767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMTDKEGGQLMPEEALDEVALGYQPPRQKSLQELQELDSDDESLTKYKQALLGPLPPASD
PSIPNVQVMRLTLMCEQAPGPVTMDLTGDLFVLKNQPFVLKEGVDYKVKITFKVNKEIVC
GLRCLHHTYRKGLR
Download sequence
Identical sequences ENSPCAP00000008192 ENSPCAP00000008192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]