SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000498 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000498
Domain Number 1 Region: 2160-2459
Classification Level Classification E-value
Superfamily BEACH domain 1.1e-123
Family BEACH domain 0.000000000025
Further Details:      
 
Domain Number 2 Region: 113-299
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-33
Family Clostridium neurotoxins, the second last domain 0.028
Further Details:      
 
Domain Number 3 Region: 2576-2651,2707-2832
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.19e-21
Family WD40-repeat 0.0072
Further Details:      
 
Domain Number 4 Region: 2048-2101,2128-2154
Classification Level Classification E-value
Superfamily PH domain-like 0.0000533
Family PreBEACH PH-like domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000000498
Domain Number - Region: 580-666
Classification Level Classification E-value
Superfamily ARM repeat 0.0896
Family MIF4G domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000498   Gene: ENSPCAG00000000390   Transcript: ENSPCAT00000000529
Sequence length 2842
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6051:8129:472030:1 gene:ENSPCAG00000000390 transcript:ENSPCAT00000000529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVGGEFDLEMNFIIQDAESITCMTELLGHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVG
LIEQVLLKMGAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGVWPRHAVKLLS
VLNQMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKP
YLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWR
NSEIRCYVNGQLVSYGDMAWHVNTSDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALN
PAQIFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCL
ESSPNASIFVHSPHALMLQDVKAIVTHSIHSAVHSVGGIQVLFPLFAQLDNRQLHDSQVE
TTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSRVHITRAVLEQFLSFAKY
LDGLSHGAPLLKQLCDHVLFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTV
LQLMHTLKYYYWVMNPADSSGITPKGLDGPGPSQKEIISLRAFMLLFLQLXXXDRGVKED
ELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESI
WVQALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVTYEAHKEYLAQMYEEYQRQEEENIKKGKKGSVSTISGLSAQTTGAKALENPE
IEDLSQSQSPESETDYPVSTDTRDLMSDKVPDDLLGHSERPGASVHVEVHDLLVDIKAEK
VEATEVKLDDMDLSPETLVAGESGALVEVGSLLDNVYSAAVEKLHNNVHSSVGIIKKNEE
KDNGPLITLADEKDELSNSSTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHLGVGDD
LGLLTHMTANVDLTCSSSLMEEKEFKIHTTSDGLSALPERDLTPSSKGXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHST
KSVMDFVNSNENIIFVHNTIHLVSQMLDNVVIACGGILPLLSAATSPTVKKTELENIEVT
QGMSAETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPLESVPGNLSPIKDPDRLLQDVDI
NRLRAVVFRDVDDSKQAQFLALAVVYFVSVLMVSKYRDILEPQRETARAGGQPGRNIRQE
INSPTSTVVVMPSIPHPSLSHGFLAKLIPEQSFAHSFYKETPAAFPDTLKEKETPTPGEE
IQIESSIPHTDSGIGEEQVASILNGVELEASAGPDAMXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSVVVPVKKPPPGSLAVTTVGTAPAGSGLATSSASNLLAAAGTTPKSMINTTGAV
DSRSSSSSSSSSFVNGATXXXXXXXXXXXXXXXXXXXXXXITAKLERALEKVAPLLREIF
VDFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQCAQYAADRREEEKMCDH
LISAAKHRDHVTANQLKQKIVNILTNKHGAWGAVSHSQLHDFWRLDYWEDDLRRRRRFVR
NAFGSTHAEAPLKAAVEYGTEDDMVKAKKTFRSQAIVSQNAETELMLEGDDDAASLLQEK
EMDNLAGPVVLSTPAQLIAPVVVAKGTLSITTTEIYFEVDEEDPAFKKIDTKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVMFNFPDQATVKKVVYSLPRVGVGTSY
GLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWV
LTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWDDDQSPPCHYNTHYSTAR
SALSWLVRIEPFTTFLLNANDGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPE
MFVNSNGYRLGVRDDDVAVSDVDLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLVFG
YKQRGPEAVRALNVFHYLTYEGSVNLESIADPVLREMEAQIQSFGQTPSQLLIEPHPPRS
SAMHLCFLPQSPLVFTDQMQQDVIMVLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLRGAPGYSLDQAHHLPIEMDPLIANSSGVSRRQITDLVDQSTQINAHCFV
VTADNRYVLICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLSRSESYIGGDCYIVSGSR
DATLLLWYWSGRHHIIGDNPNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPC
LVHTITGDLLRALEGPEDCSLPRLISVSSEGHCVIYHERGRFSNFSINGXXXXXXXXXXX
XXAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLVTGMA
SGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences ENSPCAP00000000498 ENSPCAP00000000498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]