SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000699 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000699
Domain Number 1 Region: 313-508
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-69
Family Hemopexin-like domain 0.000012
Further Details:      
 
Domain Number 2 Region: 115-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.1e-55
Family Matrix metalloproteases, catalytic domain 0.0000000242
Further Details:      
 
Domain Number 3 Region: 25-98
Classification Level Classification E-value
Superfamily PGBD-like 5.49e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000699   Gene: ENSPCAG00000000757   Transcript: ENSPCAT00000000741
Sequence length 583
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4672:63564:72001:1 gene:ENSPCAG00000000757 transcript:ENSPCAT00000000741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPTRRLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAITAMQRFYGLRVTGKADEDTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATLEAIRKAFRVWESATPLRFREVPYAYVREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGSPTRMPPQPRTT
SRPSGPDKPKNPTYGPNICDGNFDTVAVLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPASGGRPDEGTEEETEVIIIEVDEEGSGAVSA
AAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Download sequence
Identical sequences ENSPCAP00000000699 ENSPCAP00000000699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]