SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000000973 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000000973
Domain Number 1 Region: 170-488
Classification Level Classification E-value
Superfamily TPR-like 2.28e-105
Family Tetratricopeptide repeat (TPR) 0.000000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000000973   Gene: ENSPCAG00000001041   Transcript: ENSPCAT00000001035
Sequence length 490
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4901:134017:142500:1 gene:ENSPCAG00000001041 transcript:ENSPCAT00000001035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSVSPARWAEEYLEQSEEKLWLGEPEGTAATDRWYDEYHPEEDLQHMASDFVAKVDDPK
LANSEFLKFVRQIGEGQVSLESGAGSGRAQAEQWAAEFIQQQDTSEAWVDQFTRPVNTSA
LDMEFERAKSAIESDVDFWDKLQAELEEMAKRDAESHPWLSDYDDLTSASYDKGYQFEEE
NPLRDHPQPFEEGLQRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAI
SALRRCLELKPDNRTALMALAVSFTNESLQRQACETLRDWLRYSPAYAHLVTPSKERASG
TGQGPSKRLLGSLLSDSMFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVD
CFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINL
GAHRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIWSTLRLALSMLGQSDAYGAADARDLP
TLLAMFGLPQ
Download sequence
Identical sequences ENSPCAP00000000973 ENSPCAP00000000973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]