SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000001656 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000001656
Domain Number 1 Region: 182-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 154-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000279
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number 3 Region: 224-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000804
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 124-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000391
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000001656   Gene: ENSPCAG00000001788   Transcript: ENSPCAT00000001761
Sequence length 266
Comment pep:known_by_projection scaffold:proCap1:scaffold_43652:16643:19855:-1 gene:ENSPCAG00000001788 transcript:ENSPCAT00000001761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYPMPVIPQPEILSAYNPITVWTTT
APFHSPLPNDLSPLSGYPSALGRVSPPPXXXXXXXXXXXXXXXISDDEEIQSKLSDAHAD
IEAEKFQCNLCSKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHT
LPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQ
CKNCSKTFSRMSLLHKHEESGCCVAH
Download sequence
Identical sequences ENSPCAP00000001656 ENSPCAP00000001656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]