SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002997 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002997
Domain Number 1 Region: 423-612
Classification Level Classification E-value
Superfamily Fibronectin type III 8.93e-21
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 2 Region: 278-409
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000132
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002997   Gene: ENSPCAG00000003152   Transcript: ENSPCAT00000003191
Sequence length 848
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_841:29458:115134:1 gene:ENSPCAG00000003152 transcript:ENSPCAT00000003191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYSVRGCSLVFICITSWLLIKAKIDVCKRGGVTVKPSRVVSLGSAVNISCSLKPKQGCS
SYSSSDKLILYKFYRKIHFQHGLTLSYQVTDLPLGTTVFVCKLACGSSDEIRICGAEISV
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNVINAKGRHDLLDVKPYTEYEFQIASKLHL
HKGSWSDWSESLRTQTPEEEPTGLLDVWYTKQQIDYNRQQISLFWKNLSISAARGKILHY
QVTLREITEAKPTLQNITEHNSWTWVVPRTGHWTVTVSAANSKGSSLPTCVNMTDLCGAG
SLAPRQVSATSEGVDSMVVTWEPSGRAVQEYVVEWQELHPEDSARPPLNWLRRPSSSVSA
VISENIKPYICYEIRVYALSGDQAGCISTRGSAKHKAPLNGPYINVITEEKGGIFISWSR
IPAQEQMGCILRYRIYWKERNSDSQPRLQEIPYRVSQNSHLVTSVQPRATYILWMTALTA
AGESHPGNEREICLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFVLLSALRPQWYI
RKIPDPANSTWAKKYPIVEEKTQLLVDRLQTARHTPEDPETLVISEVLHQVAPAFRHPHR
LTWPERRQDVQGLCTSEHSPPRALKTKQLGDLYKVLGHGGPDTKPRNPVSPLTVLPVDFL
STHEGYLPSNIDYLPSHEAPVPDPLEELEPQHISLSVFSSSSLHPLSFSCGEKLTLDRLK
MGCGSLVL
Download sequence
Identical sequences ENSPCAP00000002997 ENSPCAP00000002997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]