SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003132 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003132
Domain Number 1 Region: 265-453
Classification Level Classification E-value
Superfamily Fibronectin type III 4.09e-29
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 38-243
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000238
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003132   Gene: ENSPCAG00000003180   Transcript: ENSPCAT00000003334
Sequence length 1821
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5320:20616:128704:1 gene:ENSPCAG00000003180 transcript:ENSPCAT00000003334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAAGAPWRAPCPLPRAPLLLLAALLAVAASAGDTVDRPLKPRNVRLLSTKMGLKVTWE
PPKDAASRPVEHYNIAYGKSLKSLSYIKVNAGTSSFLIEDVEPGVVYFVLVTAENHSGVS
RPVYRAESPPGGEWIKIDGFPIKGPAPFNETVTEKEVPNKPLRMRVRSSDDKLSVQWRAP
RLSGAKSPRRSRGFLLGYGESGRKMNYVPLSRDERTHEIKKLASESVYVVSLQSMNAQGR
SQPVYRAALTKRKIVEEDHLELTEDISVRVMSSQSVLVAWVDPALEKQKNVVASRQYTVR
YREKGESARWDYKQTPHRRVLVEDLIPDTMYEFAVRISQGERDGKWSTSVFQRTPESAPT
TAPENFNVWPVNGRPTAVTASWDPLPETEGKVKEYILSYAPALKPFGAKSLTYRGGTTSA
IVDGLQPGERYLFKIRASNRRGQGPQSKAFVVAMPATSTSESKVEQKADVEDDPQPEKPT
PSSSSPKVPASTRYTRLPVSSPSRNAKNHLLDLKNKILANGGVLRRPQLHPKKTEDADLQ
STEVSEEELESRTESRASSSETPNQKHPLRLPPPSKSFPAALSPGRTPVRAQMPTLPRKE
AMDKHSSSGSPHPAPEASPSASTSSAHHASAQGPSPEGPLLPANSADNDSIDEEDGIKEE
RAAHVPHVKSSEKLPSRMPPHSQSASSAVQERSQVNPEQRTSRPGGLEENRGIPASPRLS
PRRSSRLPPTEPPAGSPLSKGLKDSYGTGIAHSNVPSRTTMPSPASSRTPWRTQTSHGDG
DSHNDAEFRSRQAEATAPALRARLPASRPASGHLNFFRNRPFGANGRYQGRFGNGRGLRL
QPSGVPRSTVPSRVPSRVNTPSTSSHKLGAGIHGDQEDEQPLPATVINDLVPFSSKQPVS
QGPDHLRRVLQRGPGMQQKESLSGDRKSAVAEESSQDKSAMPPSKSHDVEQSSHGEGNSA
QTQPVSSGRHPAPVRPQPHPGPSAPRRTAPKQLPRIAVGQPSASARSRGRQRDGHQDDSS
EEAAQDVRLPARSAQAPEDTAALSKLRQVEAGTGLTDEKARGVPEAQAGPRGPASLPVPR
TRPWPRGVANRGAPGQLQPPSKRPQPPKSPQSVSEKEEEDAGLHKGGKDDAPLAPGPKWP
SSDPAGSRHPERHLAEDKRKPAIRLERALGWRRAPWRRPPGPGHLRAAHVPRSSATLGPV
TSTPTRPPPPTRAPPSHTETTPMLSLRQRMMQARFRNPLQRPPARPTYRQGYNGRPNIDG
NVLPGSNGKLSGQRIINGPQGTKWVVDLDRGLVLNAEGRHLQDSHGNPLRVKLGGDGRTV
VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFSGLESDTAMPTEEAYVVYDEDYEFETVRP
PATTRPSTTVATPKVISPEGSISSFPVEEFDLAGKKRFVAPYVTYLNKDPSAPCLTDALD
HFQVDSLDEIIPHELRKSGLPPRHSPRNITVVAVEGCHSFVIVDWDKATPGDVVTXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN
PLLVVRPPGGEPIWIPFTFKRDSGYTDCHGRQYVKRTWYKKFVGVVLCNSLRYKIYLSDN
LKDTFYSIGDSWGRGEDHCQFVDSYLDGRTGPQSYIEALPNIPGYYRQYRQEPVRFGHIG
FGTPYYYVGWYECGVSIPGKW
Download sequence
Identical sequences ENSPCAP00000003132 ENSPCAP00000003132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]