SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003202 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003202
Domain Number 1 Region: 424-527
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000266
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number 2 Region: 744-818
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000324
Family Fibronectin type III 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000003202
Domain Number - Region: 583-625
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000582
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number - Region: 336-413
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00304
Family C1 set domains (antibody constant domain-like) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003202   Gene: ENSPCAG00000003350   Transcript: ENSPCAT00000003407
Sequence length 1158
Comment pep:novel genescaffold:proCap1:GeneScaffold_2252:7376:71961:1 gene:ENSPCAG00000003350 transcript:ENSPCAT00000003407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCQKFSVALLYWEFIYAVTAFNLAYPITPWRFTLSCMPPNMTYDFLLPAGMSKNTSSGN
YEAVVEAKFNSSTLYFSNSTSQTTFHCCFWSEQDESCSIYADGETVFSRINSSVFQQTGA
NWNIQCWMKVDLQLFICYVEPSLKNPFKNYDLQVHLSYYLSEVLEDLSLLPQKDSFKIGQ
CNCSVHKSCECHVPVPTSRLNYTYLMFLEIASGRVTFQSPLMSAQPMNIXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVIYFPPKILTSVGSNVSFHCAYKNGNKIVSSEK
IVWWMNLAEKIPQSQYNVMSDHVSKVTLTNVNETIPRGKYTYNAVYCCTEHECHHRYAEL
YVIDVNINISCETDGYLTKMTCRWSTKSIQSLVGSTLQLRYHRRRLYCPDFPTIHPVSEP
KDCHLQSDGFHECIFEPIFLLSGYTMWIRINHSLGSLNSPPMCVVPDSMXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTYEVYDAKSKTASIVVSDLCA
VYAAQVRCKRLDGLGYWSDWSNPTYTVVTDVKVPIRGPEFWGIINEDATKREKNITLLWK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXNIIQSLSAPLNGSCVISWVLLPSDYDLMYFIIEWKLNEENEFKWNRI
PSTVKKYYVHDHFIPIEKYQFSLYPVFKEGVGKPKIISGFMQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFIKHTESVTF
GPLLLEPETISEDISVDTSWKDREEKASTTTASPRLAAPDLEKGSVCISSGQCDRTDCSE
AESTRVTCEDGSQRQPSVKYATLVSNFPSSETSEEQEPVNSSVRKYSSSKNSPLKSFFSS
SLEIEDAAFFIFSDQHPSIISPQPTFSEGLDKLKLEGDFPEENNDERSVYYLGVASLKSR
ESDGVLLTDKSRVSYPYPTHSLFTDIRILQDSCSHFVENNFNLGTSVQKTFVSYMPQFQT
CSTQTQMIVENKMCDLTV
Download sequence
Identical sequences ENSPCAP00000003202 ENSPCAP00000003202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]