SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004313 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004313
Domain Number 1 Region: 305-490
Classification Level Classification E-value
Superfamily Fibronectin type III 9.96e-16
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 2 Region: 513-704
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000357
Family Fibronectin type III 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004313   Gene: ENSPCAG00000004569   Transcript: ENSPCAT00000004598
Sequence length 950
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4065:9703:72008:1 gene:ENSPCAG00000004569 transcript:ENSPCAT00000004598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDPQPWTPESFNVSIDSPHQRLNLQWNVHNLLYHQDLQMIFEIQVSRFKASNVIWVGNY
STTVKRNQVLQWSWESELPLECATHFLRFRSMMDDSNAKPSSWSKWSSWKEVDVQDHLGH
GTLFVFPQDRLVEEGSNVTFCYVSRSHQNNISCYLEGDLIHGEQLTPNVSAFHLSHVSFI
RIKGTNICCEEKLGEDPGGTVLYVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXHRYTLSESFSQKSKLCEHRRNWCTWQVTQGSQEKYNFTLMAENLLRKRSVSLLFKLT
HRVRPMTPLNFVLEDLNSANATVTWKVHPIENATFLCQVELHRGGQIIQHNVSITVNGKR
LLSGMEPDTHYLARVRCAYGTHFWKWSEWTDQKFTTLEAAPSVAPDIWRNIVTSSEVYNV
TLFWKPLSKFHANGKILFYNIAVENLDKLILQRSVPASHNNTELSLRKDYYQIHVTANNS
VGTSPASVIVISEDPGEXXXXXXXXXXXXXXXSLSWKPRSEGVAGYVVDWCAHPQEPLCG
FQWKKFGANVTSTVVSSDAFRPGVRYNFRIYEISTKWIASLLEKKTGYSEELAPSDNPRV
TTDRLTSNSFALNWEGYSTKSQPGFIRGYHIYLKSKTEQCTSGFERTIFSDNSTVCEHKI
GNPEQKTFVVENLQPGSSYEFFVTPYTRVGRGPKGTFTEVTTTAEYXXXXXXXXXXXXXX
XXXXXXXXXXXXXXMKEKCYPDIPDPYKSSVLSLIKSKENTHLTIMNPKDCIPDAIEVVN
KLEGSKIQPLGTGKSLTETEFTTPATCLYLLPTEENPSGPGPCICFENLTYNQKVSDLGS
CGHIPVPPNAPPSELGLLNSPENLLKAVGNDYTNSLGEFRGGETSLNYVSQLASPMPGDN
SSLPVDPPMPVQCSEYKMQMAIPLSRVSCALSDDSSLSSVALLGYGEQYS
Download sequence
Identical sequences ENSPCAP00000004313 ENSPCAP00000004313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]