SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004324 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004324
Domain Number 1 Region: 133-226
Classification Level Classification E-value
Superfamily TAFH domain-like 3.27e-36
Family TAFH domain-like 0.00000289
Further Details:      
 
Domain Number 2 Region: 418-465
Classification Level Classification E-value
Superfamily Histone-fold 2.13e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004324   Gene: ENSPCAG00000004596   Transcript: ENSPCAT00000004610
Sequence length 631
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2964:6808:41225:-1 gene:ENSPCAG00000004596 transcript:ENSPCAT00000004610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQTAMAPRPAPPTSAPPVQLSTVQAPGTP
ILARQVTPTTIIKPVSHAQTAVQPAAALQRSPGGQPQLVLGGTAQTASLGTATAVQTAAP
QRTVPGATTTPTAAAETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKI
EAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPAAQATTAL
TAVVLSSSVQRTAGKTAATVTSALQSPVISLTQPTQVGVGTPGRPVPVIQQPQKPGALLR
PPQVTLTPTPMVALRQPHSRIMLTTQPQIQLNPLQSVPVVKPAVLPGTKALSTVSAQAAA
AQKNRLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLL
PAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRSRQEDPEQLRLKQKAKEMQQQ
ELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGTEGSGPGTAVPGSSGVGAPRQFTRQR
ITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSPCAP00000004324 ENSPCAP00000004324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]