SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004860 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004860
Domain Number 1 Region: 260-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.81e-17
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000716
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 104-164
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000523
Family KRAB domain (Kruppel-associated box) 0.0041
Further Details:      
 
Domain Number 4 Region: 308-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000308
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004860   Gene: ENSPCAG00000005206   Transcript: ENSPCAT00000005189
Sequence length 436
Comment pep:known_by_projection scaffold:proCap1:scaffold_38266:5646:15060:1 gene:ENSPCAG00000005206 transcript:ENSPCAT00000005189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEDRSQFGFAAKMLSEQTAALGAGWESMNVQLDGAEPQIERRNQEDGPWRTAPGPLEY
LCCDLEEEPQSLQEKAQSAPWVPPVPQEGSTGDWEMAAALLAAGSQGLVTIKDVSLCFSQ
EEWRSLDPSQTDFYGEYVMQKNCGIVVSRFPIPKLDMLSQLEGGEEQWVPDPQDLEDRDI
LRVTYTXXXXXXXXXXXXXXXXXXXMLSSVSEDTVLWNPQDESWDSMARSSKGMLLGPPL
LQEDSFSNLVCNTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLQCEKSFG
RRHHLVRHQKTHLHDKPSRCSECGKNFRCNSHLASHQRAHAEGRSCRPQEAGESLGARKR
QRTPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLLTH
QGQSPQSSWDRGTSVF
Download sequence
Identical sequences ENSPCAP00000004860 ENSPCAP00000004860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]