SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006043 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006043
Domain Number 1 Region: 122-220
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000114
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 2 Region: 836-907
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000508
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006043   Gene: ENSPCAG00000006345   Transcript: ENSPCAT00000006464
Sequence length 1077
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2109:19228:286280:-1 gene:ENSPCAG00000006345 transcript:ENSPCAT00000006464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGKCNMLSSLGCLLLCGSIALALGNAQKLPKGKRPNLKVHINTTSDSIFLKFLRPNPNV
KLEGFLLGYGSNLSPNQYFPLPAEGKYTEAVVDVEPKYLIVVRPAPPPSQKKSCSGKTRT
RKPLQLVIGSLTSSSVFLSWGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQLC
PSTETIVENLKPNTVYEFGVKDNVDGGIWSKVFNHKTIVEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIQNVTHRASIKSPDRTPLGGTIVVHLIVPGLNETTIKLPASIMLE
ISDAIKTQVAKNETLALPAESKTPEVEKIPARPITVTPETVPRTTKPTVPDALDISETVL
ASSEKPRIEPTTKMSEDLKVLQSQTATHNVASVFPSPTASDEPELSKPHTATSEPILDSF
PPKTSRTLEWPSATLAASETSLVPQKLETLIIEIQRTTPAAQPTTAIPSTSKRRHKPKPS
RTKTXXKTTRPGKITSKIPEISEPTHTTMAPGKTQFISLKPKLSLSSEEIHTKAAPKQTP
HAPSKPRASPRPRIPQTQPAPKESQRVIFKPKPSPSPEVSYTTLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETDQSTQEHFTTRTPQTTELAKTTRAPH
RLYTTPARPRTTARSHIKPGVRQSLETGAGRNVSVDSTHSTKKPGTHHRPLTPRPTPLQR
KPLPRNNVTGKPGRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXN
VTDFSSSPTRETDPLGKPRFTGPHVRYIQKPDNRPCSITDSIKRFPKEEALEGNATSPPQ
NPPTNLTVVTVEGCPSFVILDWDKPLNDTVTEYEVISRENGTFSGKNKSIQITNQTFSTV
ENLKPNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRDAIWTERPFNSDS
YSECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDLRGHGEDHCQFVDS
FLDGRTGQQLTSNQLPLKEGYYRAVRQEPVQFGEIGGHTQINYVQWYECGTTIPGKW
Download sequence
Identical sequences ENSPCAP00000006043 ENSPCAP00000006043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]