SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006068 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006068
Domain Number 1 Region: 233-413
Classification Level Classification E-value
Superfamily TPR-like 3.58e-27
Family Tetratricopeptide repeat (TPR) 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000006068
Domain Number - Region: 107-159
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006068   Gene: ENSPCAG00000006500   Transcript: ENSPCAT00000006491
Sequence length 515
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1521:3368:9984:1 gene:ENSPCAG00000006500 transcript:ENSPCAT00000006491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTPRSQQCGAAMSVKVAAPGDMGLGSERLSSEELVQQTRQVVQGLEALRAEHRGLAGHLA
EALAGQGPAVGLELLEEKHQVVSHSLEAIELGLGEAQVLLALSAHMGALEAEKQRLRAHA
RRLAQENAWLREELEETQRRLRASEEAVAQLEEEKSHLEFLGQLRQYDAPAESQQPESPP
RRDSLASLFPSEEERKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLC
RQALEDLERSSGHCHPDVATMLNILALVYRDQNKYKEATDLLQDALQIREQTLGPEHPAV
AATLNNLAVLYGKRGRYREAEPLCQRALEIREKVLGTDHPDVAKQLNNLALLCQNQGKFE
EVEQHYARALSIYEALGGPRDPNVAKTKNNLASAYLKQNKYQQAEELYKEILSREDLPAP
LGAPATDRAGDADQQALRRSSSFSKLRESIRRGSEKLVSRLRGEGVAGAAGMKRAMSLNT
LNVDGPRATGTQFPNWHLSEAPQTLSASTQDLGRR
Download sequence
Identical sequences ENSPCAP00000006068 ENSPCAP00000006068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]