SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006897 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006897
Domain Number 1 Region: 338-533
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.2e-70
Family Hemopexin-like domain 0.00000734
Further Details:      
 
Domain Number 2 Region: 136-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.88e-41
Family Matrix metalloproteases, catalytic domain 0.00000035
Further Details:      
 
Domain Number 3 Region: 26-94
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000706
Family MMP N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006897   Gene: ENSPCAG00000007377   Transcript: ENSPCAT00000007368
Sequence length 608
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4709:50844:240771:-1 gene:ENSPCAG00000007377 transcript:ENSPCAT00000007368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGAEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIKNVTPKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMVXXXXXXXXXXXXXXXXXXXXXXXXXXXPPDKIPPP
TRPLPTVPPHRSIPPVDPKKNDRPKPPRPPTGRPSHPGAKPNICDGNFNTLAILRREMFV
FKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTL
QPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITV
WKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRD
KEGPSPPDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYC
KRSMQEWV
Download sequence
Identical sequences ENSPCAP00000006897 ENSPCAP00000006897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]