SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007380 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007380
Domain Number 1 Region: 317-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000208
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 54-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000107
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 265-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000679
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 361-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000115
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007380   Gene: ENSPCAG00000007823   Transcript: ENSPCAT00000007884
Sequence length 416
Comment pep:novel scaffold:proCap1:scaffold_63014:410:12129:1 gene:ENSPCAG00000007823 transcript:ENSPCAT00000007884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITWPDPSLGSKGVLLKYREDMETFNKLAEKHKAKDVSSKDIDWLQEKEPTKVPEHITFED
VTVVFTEAEWKGLSSEQKDLYKEVMLEIYRHLLSLAEPKPELYPWSSCLLDVSCQQFLSQ
QLLPVLPGLCAENHLHPEYSSPGRQKQLEQQGFDHKWWSENTEVHERDFKPLCRRKGERE
VRETSRALRPSHGLASPKKDKAVIGAEPNTSERVVETENGLKELESSGFAAVIEDEPECG
LNSEVITNQNLLQEEPSVCCDFGDFGQNSNLTKNQRAHSGEKCVCSDCRVFTQSYLVMHQ
RTHSGKKPYIYSECGGFKWKSVLLTHQTVHLGEKPAACTVCGQGFRSKAGLFVYQRTHSE
KPYVCIECGQGFTQNLVLIIHQMLYSGEKPYVCECGFIHRSLIRHQRIQEAENPYV
Download sequence
Identical sequences ENSPCAP00000007380 ENSPCAP00000007380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]